PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn154701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 172aa    MW: 19194.5 Da    PI: 6.9473
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn154701genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.74.7e-272373151
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                k+rl+Wt+eLH+ F +av+qLGG+++AtPk il++m+++gLt++hvkSHLQ
  Achn154701 23 KERLKWTQELHDLFEKAVNQLGGADRATPKGILKAMGIQGLTIYHVKSHLQ 73
                68************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-242173IPR009057Homeodomain-like
SuperFamilySSF466893.05E-142273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-202373IPR006447Myb domain, plants
PfamPF002499.4E-92573IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MPRRVAQTPD SEMGSSRSDG SGKERLKWTQ ELHDLFEKAV NQLGGADRAT PKGILKAMGI  60
QGLTIYHVKS HLQLPSLCED SESNAKEFES DSEIDKTEVR SEEEFRAPKS PKRARVAENV  120
LLPRYKVASL DFQSYNQSML ARVVHPSCET SFPWSVAASQ SPFMPSLYNY N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580205.13e-44PREDICTED: transcription repressor KAN1
TrEMBLB9SQ159e-48B9SQ15_RICCO; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-24G2-like family protein